Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4) , partial (Active)
CAT:
399-CSB-AP005301MO-01
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4) , partial (Active)
- CAS Number: 9000-83-3
- Gene Name: Ctla4
- UniProt: P09793
- Expression Region: 37-161aa
- Organism: Mus musculus
- Target Sequence: AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD
- Tag: C-terminal 6xHis-tagged
- Source: Mammalian cell
- Field of Research: Immunology
- Assay Type: Active Protein & In Stock Protein
- Relevance: Mouse Cytotoxic Tlymphocyte 4 (CTLA-4, CD152), is a type I transmembrane T cell inhibitory molecule. mouse CTLA4 cDNA encodes 223 amino acids (aa) including a 35 aa signal sequence, a 126 aa extracellular domain (ECD) with one Ig-like V-type domain, a 21 aa transmembrane (TM) sequence, and a 41 aa cytoplasmic sequence. Within the ECD, Mouse CTLA-4 shares 68% aa sequence identity with human. CTLA4 is similar to the T cell costimulatory protein CD28 since both of the molecules bind to CD80 and CD86 on antigen-presenting cells. CTLA4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal. Intracellular CTLA4 is also found inregulatory T cells and may play an important role in their functions. T cell activation through the T cell receptor and CD28 leads to increased expression of CTLA4. Genetic variations of CTLA4 have been associated with susceptibility to systemic lupus erythematosus (SLE), Gravesdisease (GRD), Celiac disease type3 (CELIAC3) and Hepatitis B virus infection (HBVinfection).
- Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
- Purity: Greater than 95% as determined by SDS-PAGE.
- Activity: Yes
- Bioactivity: Measured by its binding ability in a functional ELISA. Immobilized Mouse B7-1-Fc at 5μg/ml can bind Mouse CTLA-4-His, the ED50 of Recombinant Mouse CTLA-4-His is 2-10 ng/ml.
- Length: Partial
- Form: Lyophilized powder
- Buffer: Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Function: Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
- Molecular Weight: 14.6 kDa
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.