Recombinant Mycobacterium bovis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB)

CAT:
399-CSB-EP374472MOJb1-03
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mycobacterium bovis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB) - image 1

Recombinant Mycobacterium bovis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB)

  • Product Name Alternative:

    DGAT;30 kDa extracellular protein; Acyl-CoA:diacylglycerol acyltransferase; Antigen 85 complex B;85B; Ag85B; Extracellular alpha-antigen; Fibronectin-binding protein B; Fbps B
  • Abbreviation:

    Recombinant Mycobacterium bovis fbpB protein
  • Gene Name:

    FbpB
  • UniProt:

    A1KJU9
  • Expression Region:

    41-325aa
  • Organism:

    Mycobacterium bovis (strain BCG / Pasteur 1173P2)
  • Target Sequence:

    FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETLLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of Mycobacteria to murine alveolar macrophages (AMs) . They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha, alpha-trehalose dimycolate (TDM, cord factor) . They catalyze the transfer of a mycoloyl residue from one molecule of alpha, alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 95% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    38.1 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein