Recombinant Human T-cell antigen CD7 (CD7) , partial (Active)

CAT:
399-CSB-MP004953HU-02
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human T-cell antigen CD7 (CD7) , partial (Active) - image 1

Recombinant Human T-cell antigen CD7 (CD7) , partial (Active)

  • Gene Name:

    CD7
  • UniProt:

    P09564
  • Expression Region:

    26-180aa
  • Organism:

    Homo sapiens
  • Target Sequence:

    AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
  • Tag:

    C-terminal hFc-Myc-tagged
  • Source:

    Mammalian cell
  • Field of Research:

    Immunology
  • Assay Type:

    Active Protein & In Stock Protein
  • Endotoxin:

    Less than 1.0 EU/ug as determined by LAL method.
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Yes
  • Bioactivity:

    ①Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 μg/ml can bind SECTM1 (CSB-MP819898HU), the EC50 is 1.236-1.773 ng/ml.②Human CD7 protein hFc and Myc tag (CSB-MP004953HU) captured on COOH chip can bind Human SECTM1 protein hFc tag (CSB-MP819898HU) with an affinity constant of 1.84 nM as detected by LSPR Assay.
  • Length:

    Partial
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    46.5 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • Protein Length:

    Partial
  • CAS Number:

    9000-83-3