Recombinant Quercus alba Major pollen allergen Que a 1, partial
CAT:
399-CSB-EP307655QAA-03
Size:
20 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Quercus alba Major pollen allergen Que a 1, partial
- CAS Number: 9000-83-3
- UniProt: P85126
- Expression Region: 1-50aa
- Organism: Quercus alba (White oak)
- Target Sequence: GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP
- Tag: N-terminal 6xHis-B2M-tagged
- Source: E.coli
- Field of Research: Others
- Assay Type: In Stock Protein
- Purity: Greater than 85% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Partial
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 19.4 kDa
- References & Citations: "Purification and characterization of the major oak pollen allergen Que a 1 for use in component resolved diagnostics using ImmunoCAP." Moverare R., Everberg H., Carlsson R., Holtz A., Thunberg R., Olsson P., Brostedt P., Hoegbom E. Allergy 146:203-211 (2008)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.