Recombinant Mouse Peptide YY (Pyy) , partial

CAT:
399-CSB-EP019128MO-02
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse Peptide YY (Pyy) , partial - image 1

Recombinant Mouse Peptide YY (Pyy) , partial

  • Gene Name:

    Pyy
  • UniProt:

    Q9EPS2
  • Expression Region:

    29-64aa
  • Organism:

    Mus musculus
  • Target Sequence:

    YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY
  • Tag:

    N-terminal GST-tagged
  • Source:

    E.coli
  • Field of Research:

    Others
  • Assay Type:

    In Stock Protein
  • Relevance:

    This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Length:

    Partial
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    31.2 kDa
  • References & Citations:

    "Expression of neurogenin3 reveals an islet cell precursor population in the pancreas." Schwitzgebel V.M., Scheel D.W., Conners J.R., Kalamaras J., Lee J.E., Anderson D.J., Sussel L., Johnson J.D., German M.S. Development 127:3533-3542 (2000)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • CAS Number:

    9000-83-3