Recombinant Mouse Macrophage colony-stimulating factor 1 (Csf1) , partial (Active)

CAT:
399-CSB-AP003641MO-01
Size:
50 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse Macrophage colony-stimulating factor 1 (Csf1) , partial (Active) - image 1

Recombinant Mouse Macrophage colony-stimulating factor 1 (Csf1) , partial (Active)

  • Gene Name:

    Csf1
  • UniProt:

    P07141
  • Expression Region:

    33-262aa
  • Organism:

    Mus musculus
  • Target Sequence:

    KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE
  • Tag:

    Tag-Free
  • Source:

    Mammalian cell
  • Field of Research:

    Immunology
  • Assay Type:

    Active Protein & In Stock Protein
  • Relevance:

    Macrophage colony-stimulating factor 1 (M-csf) is a single-pass type I membrane protein . It is a hematopoietic growth factor that is involved in the proliferation, differentiation, and survival of monocytes, macrophages, and bone marrow progenitor cells. M-CSF affects macrophages and monocytes in several ways, including stimulating increased phagocytic and chemotactic activity, and increased tumour cell cytotoxicity. The role of M-CSF is not only restricted to the monocyte/macrophage cell lineage. By interacting with its membrane receptor, M-CSF also modulates the proliferation of earlier hematopoietic progenitors and influence numerous physiological processes involved in immunology, metabolism, fertility and pregnancy.
  • Endotoxin:

    Less than 1.0 EU/µg as determined by LAL method.
  • Purity:

    Greater than 95% as determined by SDS-PAGE.
  • Activity:

    Yes
  • Bioactivity:

    The ED50 as determined in a cell proliferation assay using M‑NFS‑60 mouse myelogenous leukemia lymphoblast cells is 0.04-0.2 ng/ml.
  • Length:

    Partial
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.
  • Molecular Weight:

    26 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • CAS Number:

    9000-83-3