Recombinant Rabbit Interleukin-10 (IL10)

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS1451355-01	Recombinant Rabbit Interleukin-10 (IL10)
MBS1451355-03	Recombinant Rabbit Interleukin-10 (IL10)
MBS1451355-04	Recombinant Rabbit Interleukin-10 (IL10)
MBS1451355-05	Recombinant Rabbit Interleukin-10 (IL10)
MBS1451355-02	Recombinant Rabbit Interleukin-10 (IL10)
KT-18967	Rabbit Interleukin 10 (IL10) ELISA
MBS020488-INQUIRE	Rabbit Interleukin 10 ELISA Kit
MBS724757-01	Rabbit Interleukin 10 ELISA Kit
MBS724757-03	Rabbit Interleukin 10 ELISA Kit
abx650995-5mg	Rabbit Interleukin 10 (IL10) Protein

CAT:

399-CSB-EP874667RBc7-03

Size:

20 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Rabbit Interleukin-10 (IL10)

Gene Name: IL10
UniProt: Q9TSJ4
Expression Region: 19-178aa
Organism: Oryctolagus cuniculus (Rabbit)
Target Sequence: SRGQDTPAENSCIHFPGGLPHMLRELRAAFGRVKTFFQSKDQLNSMLLTESLLEDLKGYLGCQALSEMIQFYLKDVMPQAENHSPAIREHVNSLGENLKTLRLRLRQCHRFLPCENKSKAVEQVKSAFSKLQEEGVYKAMSEFDIFINYIETYMTMKIKS
Tag: C-terminal 6xHis-tagged
Source: E.coli
Field of Research: Cancer
Assay Type: Developed Protein
Relevance: Major immune regulatory cytokine that acts on many cells of the immune system where it has profound anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptor comprising IL10RA and IL10RB leading to JAK1 and STAT2-mediated phosphorylation of STAT3. In turn, STAT3 translocates to the nucleus where it drives expression of anti-inflammatory mediators. Targets antigen-presenting cells (APCs) such as macrophages and monocytes and inhibits their release of pro-inflammatory cytokines including granulocyte-macrophage colony-stimulating factor /GM-CSF, granulocyte colony-stimulating factor/G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8 and TNF-alpha. Interferes also with antigen presentation by reducing the expression of MHC-class II and co-stimulatory molecules, thereby inhibiting their ability to induce T cell activation. In addition, controls the inflammatory response of macrophages by reprogramming essential metabolic pathways including mTOR signaling.
Purity: Greater than 95% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length of Mature Protein
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 25.3 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Rabbit Interleukin-10 (IL10), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on

Cat	Name
CSB-EP874667RBc7-03	Recombinant Rabbit Interleukin-10 (IL10)
CSB-EP874667RBc7-02	Recombinant Rabbit Interleukin-10 (IL10)
CSB-EP874667RBc7-01	Recombinant Rabbit Interleukin-10 (IL10)
CSB-E06897Rb-04	Rabbit Interleukin 10, IL-10 ELISA Kit
CSB-E06897Rb-01	Rabbit Interleukin 10, IL-10 ELISA Kit
CSB-E06897Rb-03	Rabbit Interleukin 10, IL-10 ELISA Kit
CSB-E06897Rb-02	Rabbit Interleukin 10, IL-10 ELISA Kit
CSB-EP4099OEIb1-03	Recombinant Oncorhynchus mykiss Interleukin-10
CSB-EP4099OEIb1-02	Recombinant Oncorhynchus mykiss Interleukin-10
CSB-EP4099OEI-02	Recombinant Oncorhynchus mykiss Interleukin-10