Recombinant Mouse Small proline-rich protein 4 (Sprr4) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS1427430-01	Recombinant Mouse Small acidic protein (Smap)
MBS1427430-02	Recombinant Mouse Small acidic protein (Smap)
MBS1426862-01	Recombinant Mouse Small muscular protein (Smpx)
MBS1426862-02	Recombinant Mouse Small muscular protein (Smpx)
MBS1426862-03	Recombinant Mouse Small muscular protein (Smpx)
MBS1426862-04	Recombinant Mouse Small muscular protein (Smpx)
MBS1426862-05	Recombinant Mouse Small muscular protein (Smpx)
MBS1427430-03	Recombinant Mouse Small acidic protein (Smap)
MBS1427430-04	Recombinant Mouse Small acidic protein (Smap)
MBS1427430-05	Recombinant Mouse Small acidic protein (Smap)

Recombinant Mouse Small proline-rich protein 4 (Sprr4)

CAT:

399-CSB-EP022620MO-03

Size:

20 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Mouse Small proline-rich protein 4 (Sprr4)

Gene Name: Sprr4
UniProt: Q8CGN8
Expression Region: 1-76aa
Organism: Mus musculus
Target Sequence: MPSHQHQNQQQCTPQAQQQQVKQPCQPPPTKCQEACVPKTKDPCVPQAKKQCPARSTTNPAQEKCPAQQDPKCKQK
Tag: C-terminal 6xHis-tagged
Source: E.coli
Field of Research: Cell Biology
Assay Type: Developed Protein
Relevance: Cross-linked envelope protein of keratinocytes. Involved in UV-induced cornification.
Purity: Greater than 95% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 15.4 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Mouse Small proline-rich protein 4 (Sprr4), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP022612MO-02	Recombinant Mouse Small proline-rich protein 2A1 (Sprr2a1)
CSB-BP022613MO-03	Recombinant Mouse Small proline-rich protein 2B (Sprr2b)
CSB-EP720290MO-03	Recombinant Mouse U1 small nuclear ribonucleoprotein A (Snrpa)
CSB-EP720290MO-01	Recombinant Mouse U1 small nuclear ribonucleoprotein A (Snrpa)
CSB-EP022620MO-01	Recombinant Mouse Small proline-rich protein 4 (Sprr4)
CSB-EP022613MOc0-01	Recombinant Mouse Small proline-rich protein 2B (Sprr2b)
CSB-EP022620MO-03	Recombinant Mouse Small proline-rich protein 4 (Sprr4)
CSB-EP022620MO-02	Recombinant Mouse Small proline-rich protein 4 (Sprr4)
CSB-YP022616MO-03	Recombinant Mouse Small proline-rich protein 2E (Sprr2e)
CSB-YP022616MO-02	Recombinant Mouse Small proline-rich protein 2E (Sprr2e)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on