Recombinant Mouse Cellular communication network factor 6 (Ccn6)

CAT:
399-CSB-BP026121MO-03
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse Cellular communication network factor 6 (Ccn6) - image 1

Recombinant Mouse Cellular communication network factor 6 (Ccn6)

  • Product Name Alternative:

    (CCN family member 6) (WNT1-inducible-signaling pathway protein 3) (WISP-3)
  • Abbreviation:

    Recombinant Mouse Ccn6 protein
  • Gene Name:

    Ccn6
  • UniProt:

    D3Z5L9
  • Expression Region:

    24-354aa
  • Organism:

    Mus musculus (Mouse)
  • Target Sequence:

    SAPQDSTPGGRPGAALEVYQRTEVCRWPCRCPPQRPTCPPGVSLVRDGCGCCKVCAKQPGDTCNEAEICDPHKGLYCDYSGDTPRYETGVCAYLVAVGCEFNRVYYQNGQVFQPHPLFSCLCVSGAIGCTPLFIPKLAGSNCSAAKGRRKTDPPNCGRGTLQQQNSASYKTMSAYRNLPLTWRKKCLVQATKWTPCSRTCGMGISNRVTNDNANCEMRKERRLCYIQPCSRNTSQAVKIPRGETCQPTFQLPKAEKFVFSGCSSTQSYRPTFCGICLDKRCCVPNKSKMITVRFDCPSEGSFKWQMLWVTSCVCQRDCREPGDIFSELRIL
  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Type:

    Developed Protein
  • Source:

    Baculovirus
  • Field of Research:

    Immunology
  • Relevance:

    Plays a role in mitochondrial electron transport and mitochondrial respiration.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    40.6 kDa
  • References & Citations:

    "WISP3, the gene responsible for the human skeletal disease progressive pseudorheumatoid dysplasia, is not essential for skeletal function in mice." Kutz W.E., Gong Y., Warman M.L. Mol. Cell. Biol. 25:414-421 (2005)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein