Recombinant Human Inactive hydroxysteroid dehydrogenase-like protein 1 (HSDL1) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS9421286-02	Recombinant Human Inactive phospholipase D5
MBS9421286-03	Recombinant Human Inactive phospholipase D5
GWB-A4C885	MAPK14 inactive Human Recombinant Protein
MBS9421286-01	Recombinant Human Inactive phospholipase D5
MBS969738-02	Recombinant Human Inactive phospholipase D5
MBS969738-03	Recombinant Human Inactive phospholipase D5
MBS969738-04	Recombinant Human Inactive phospholipase D5
GWB-912000	ERK2 inactive Human Recombinant Protein
GWB-PSB79D	Akt1 inactive Human Recombinant Protein
MBS9421286-04	Recombinant Human Inactive phospholipase D5

Recombinant Human Inactive hydroxysteroid dehydrogenase-like protein 1 (HSDL1)

CAT:

399-CSB-EP664853HUe0-01

Size:

1 mg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Inactive hydroxysteroid dehydrogenase-like protein 1 (HSDL1)

Gene Name: HSDL1
UniProt: Q3SXM5
Expression Region: 2-330aa
Organism: Homo sapiens
Target Sequence: AAVDSFYLLYREIARSCNCYMEALALVGAWYTARKSITVICDFYSLIRLHFIPRLGSRADLIKQYGRWAVVSGATDGIGKAYAEELASRGLNIILISRNEEKLQVVAKDIADTYKVETDIIVADFSSGREIYLPIREALKDKDVGILVNNVGVFYPYPQYFTQLSEDKLWDIINVNIAAASLMVHVVLPGMVERKKGAIVTISSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYASKGIFVQSLIPFYVATSMTAPSNFLHRCSWLVPSPKVYAHHAVSTLGISKRTTGYWSHSIQFLFAQYMPEWLWVWGANILNRSLRKEALSCTA
Tag: N-terminal GST-tagged
Source: E.coli
Field of Research: Tags & Cell Markers
Assay Type: Developed Protein
Purity: Greater than 85% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length of Mature Protein
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 64.3 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Inactive hydroxysteroid dehydrogenase-like protein 1 (HSDL1), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP836686HU-03	Recombinant Human Inactive phospholipase D5 (PLD5)
CSB-EP836686HU-02	Recombinant Human Inactive phospholipase D5 (PLD5)
CSB-EP836686HU-01	Recombinant Human Inactive phospholipase D5 (PLD5)
CSB-EP002171HU-03	Recombinant Human Putative inactive neutral ceramidase B (ASAH2B)
CSB-YP002171HU-02	Recombinant Human Putative inactive neutral ceramidase B (ASAH2B)
CSB-YP002171HU-01	Recombinant Human Putative inactive neutral ceramidase B (ASAH2B)
CSB-YP002171HU-03	Recombinant Human Putative inactive neutral ceramidase B (ASAH2B)
CSB-EP002171HU-02	Recombinant Human Putative inactive neutral ceramidase B (ASAH2B)
CSB-EP002171HU-01	Recombinant Human Putative inactive neutral ceramidase B (ASAH2B)
CSB-EP664853HUe0-01	Recombinant Human Inactive hydroxysteroid dehydrogenase-like protein 1 (HSDL1)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on