Recombinant Mouse Insulin growth factor-like family member (Igfl)
CAT:
399-CSB-EP728153MO-01
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

Recombinant Mouse Insulin growth factor-like family member (Igfl)
- CAS Number: 9000-83-3
- Gene Name: Igfl
- UniProt: Q6B9Z0
- Expression Region: 25-140aa
- Organism: Mus musculus
- Target Sequence: RKISTFSGPGSWPCNPKCDGRTYNPSEECCVHDTILPFKRINLCGPSCTYRPCFELCCPESYSPKKKFIVKLKVHGERSHCSSSPISRNCKSNKIFHGEDIEDNQLSLRKKSGDQP
- Tag: N-terminal 6xHis-SUMO-tagged
- Source: E.coli
- Field of Research: Signal Transduction
- Assay Type: In Stock Protein
- Relevance: Probable ligand of the IGFLR1 cell membrane receptor.
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Full Length of Mature Protein
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 26.1 kDa
- References & Citations: "Murine IGFL and human IGFL1 are induced in inflammatory skin conditions and bind to a novel TNF receptor family member, IGFLR1." Lobito A.A., Ramani S.R., Tom I., Bazan J.F., Luis E., Fairbrother W.J., Ouyang W., Gonzalez L.C. J. Biol. Chem. 286:18969-18981 (2011)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.