Login

Recombinant Mouse GDNF family receptor alpha-like (Gfral) , partial (Active)

CAT:
399-CSB-MP750964MO1-02
Size:
100 µg
Price:
Ask
For price, please contact [email protected]
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse GDNF family receptor alpha-like (Gfral) , partial (Active) - image 1
Recombinant Mouse GDNF family receptor alpha-like (Gfral) , partial (Active) - image 2
Recombinant Mouse GDNF family receptor alpha-like (Gfral) , partial (Active) - image 3
Recombinant Mouse GDNF family receptor alpha-like (Gfral) , partial (Active) - image 4
Thumbnail 1
Thumbnail 2
Thumbnail 3
Thumbnail 4

Recombinant Mouse GDNF family receptor alpha-like (Gfral) , partial (Active)

  • CAS Number: 9000-83-3
  • Gene Name: Gfral
  • UniProt: Q6SJE0
  • Expression Region: 20-349aa
  • Organism: Mus musculus
  • Target Sequence: QTNDCAHLIQKCLIDANGCEQSWRSMEDTCLTPGDSCKINNSLHCNLSIQALVEKNFQFKECLCMDDLHCTVNKLFGKKCTNKTDNMEKDNKDKWNLTTTPFYHGFKQMQSCLEVTEACVGDVVCNAQLALYLKACSANGNLCDVKHCQAAIRFFYQNMPFNTAQMLAFCDCAQSDIPCQQSKETLHSKPCALNIVPPPTCLSVIHTCRNDELCRTHYRTFQTECWPHITGKCHEDETCISMLGKQDLTCSGSESCRAAFLGTFGTVLQVPCACRGVTQAEEHVCMIFQHMLHSKSCFNYPTPNVKDISSYEKKNSKEITLTGFNSFFNG
  • Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Source: Mammalian cell
  • Field of Research: Cell Biology
  • Assay Type: Active Protein & In Stock Protein
  • Relevance: Brainstem-restricted receptor for GDF15 which regulates food intake, energy expenditure and body weight in response to metabolic and toxin-induced stresses (PubMed:28953886, PubMed:28846099, PubMed:28846097, PubMed:28846098). Upon interaction with its ligand, GDF15, interacts with RET and induces cellular signaling through activation of MAPK- and AKT- signaling pathways (PubMed:28846098, PubMed:28846099).
  • Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
  • Purity: Greater than 95% as determined by SDS-PAGE.
  • Activity: Yes
  • Bioactivity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Gfral at 5 μg/mL can bind Mouse Gdf15 (CSB-MP859530MO), the EC50 is 7.926-10.52 ng/mL.
  • Length: Partial
  • Form: Lyophilized powder
  • Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
  • Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight: 42.1 kDa
  • References & Citations: "The metabolic effects of GDF15 are mediated by the orphan receptor GFRAL." Emmerson P.J., Wang F., Du Y., Liu Q., Pickard R.T., Gonciarz M.D., Coskun T., Hamang M.J., Sindelar D.K., Ballman K.K., Foltz L.A., Muppidi A., Alsina-Fernandez J., Barnard G.C., Tang J.X., Liu X., Mao X., Siegel R. Wu X. Nat. Med. 23:1215-1219 (2017)
  • Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • Protein Length: Partial