Swine CCL4 (MIP-1 beta) Recombinant Protein
CAT:
908-RP0069S-04
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Swine CCL4 (MIP-1 beta) Recombinant Protein
Background:
CCL4 belongs to the CC chemokine family and is commonly known as MIP-1β. There are at least 27 distinct members of the C-C subgroup reported for mammals. They are characterized by two adjacent cysteines. CC chemokines induce the migration of monocytes and other cell types such as NK cells and dendritic cells. CCL4 is a chemoattractant for natural killer cells, monocytes and a variety of other immune cells. CCL4 is involved in several inflammatory and autoimmune diseases including viral infection such as HIV-1/AIDS.Description:
The Swine CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APMGSDPPTSCCFTYTVRKLPRNFVTDYYETSSLCSQPAVVFQTKKGRQVCANPSDDWVQEYMDDLELN) . For research use only.Applications:
Cell Culture, ELISA Standard, ELISpot Control, Western Blot ControlHomology:
Sus scrofa (pig)Storage Temperature:
-20°C