Recombinant Macaca mulatta Leukocyte surface antigen CD47 (CD47), partial (Active)

CAT:
399-CSB-MP6802MOW-02
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Macaca mulatta Leukocyte surface antigen CD47 (CD47), partial (Active) - image 1

Recombinant Macaca mulatta Leukocyte surface antigen CD47 (CD47), partial (Active)

  • Product Name Alternative:

    /
  • Abbreviation:

    Recombinant Rhesus macaque CD47 protein, partial (Active)
  • Gene Name:

    CD47
  • UniProt:

    F7A802
  • Expression Region:

    19-141aa
  • Organism:

    Macaca mulatta (Rhesus macaque)
  • Target Sequence:

    QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTAPANFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNE
  • Tag:

    C-terminal 10xHis-tagged
  • Type:

    Active Protein & In Stock Protein
  • Source:

    Mammalian cell
  • Field of Research:

    Cancer
  • Relevance:

    Leukocyte surface antigen CD47; Integrin-associated protein; CD47
  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.
  • Purity:

    Greater than 95% as determined by SDS-PAGE.
  • Activity:

    Yes
  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Macaca mulatta CD47 at 2 μg/mL can bind Anti-CD47 recombinant antibody (CSB-RA004940MA1HU) . The EC50 is 4.473-4.933 ng/mL.
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    15.3 kDa
  • References & Citations:

    Evolutionary and biomedical insights from the rhesus macaque genome. Gibbs R.A., Rogers J., Katze M.G., Bumgarner R., Weinstock G.M., Mardis E.R., Remington K.A., Strausberg R.L., Venter J.C., Zwieg A.S. Science 316:222-234 (2007)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial