MTF2 Rabbit pAb (APR27085N)

• Background:

  Polycomb group (PcG protein that specifically binds histone H3 trimethylated at 'Lys-36' (H3K36me3 and recruits the PRC2 complex, thus enhancing PRC2 H3K27me3 methylation activity. Regulates the transcriptional networks during embryonic stem cell self-renewal and differentiation (By similarity. Promotes recruitment of the PRC2 complex to the inactive X chromosome in differentiating XX ES cells and PRC2 recruitment to target genes in undifferentiated ES cells (By similarity. Required to repress Hox genes by enhancing H3K27me3 methylation of the PRC2 complex (By similarity. In some conditions may act as an inhibitor of PRC2 activity: able to activate the CDKN2A gene and promote cellular senescence by suppressing the catalytic activity of the PRC2 complex locally (By similarity. Binds to the metal-regulating-element (MRE of MT1A gene promoter (By similarity.

• Synonyms:

  MTF2; M96; PCL2; TDRD19A; dJ976O13.2

• Gene ID:

  22823

• UniProt:

  Q9Y483

• Cellular Locus:

  Nucleus

• Dilution:

  WB 1:500 - 1:2000 IF 1:50 - 1:100

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 29kDa/55kDa/60kDa/67kDa Observed MW: 67kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MTF2 Rabbit pAb (APR27085N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=22823

• Uniprot URL:

  https://www.uniprot.org/uniprot/Q9Y483

• AA Sequence:

  MRDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLE