TPPP3 Rabbit pAb (APR26838N)

CAT:
882-APR26838N-03
Size:
200 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
TPPP3 Rabbit pAb (APR26838N) - image 1

TPPP3 Rabbit pAb (APR26838N)

  • Background:

    Regulator of microtubule dynamic that has microtubule bundling activity. Required for embryo implantation; possibly by regulating beta-catenin (By similarity. Also required for decidualization via regulation of beta-catenin.
  • Synonyms:

    TPPP3; CGI-38; TPPP/p20; p20; p25gamma
  • Gene ID:

    51673
  • UniProt:

    Q9BW30
  • Cellular Locus:

    Cytoplasm, cytoskeleton
  • Dilution:

    WB 1:500 - 1:2000 IHC 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 18kDa Observed MW: 19KDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TPPP3 Rabbit pAb (APR26838N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51673
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q9BW30
  • AA Sequence:

    MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK