MAPKAP1 Rabbit pAb (APR26718N)

CAT:
882-APR26718N-02
Size:
100 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
MAPKAP1 Rabbit pAb (APR26718N) - image 1

MAPKAP1 Rabbit pAb (APR26718N)

  • Background:

    This gene encodes a protein that is highly similar to the yeast SIN1 protein, a stress-activated protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been described. Alternate polyadenylation sites as well as alternate 3' UTRs have been identified for transcripts of this gene.
  • Synonyms:

    MAPKAP1; JC310; MIP1; SIN1; SIN1b; SIN1g
  • Gene ID:

    79109
  • UniProt:

    Q9BPZ7
  • Cellular Locus:

    Cell membrane, Cytoplasmic vesicle, Nucleus, Peripheral membrane protein
  • Dilution:

    WB 1:500 - 1:2000 IHC 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 36kDa/37kDa/41kDa/53kDa/54kDa/59kDa Observed MW: 69KDa/71KDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MAPKAP1 Rabbit pAb (APR26718N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=79109
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q9BPZ7
  • AA Sequence:

    GDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRASTARADYFAQKQRKLNRRTSFSFQKEKKSGQQ