CACNG2 Rabbit pAb (APR26614N)

CAT:
882-APR26614N-02
Size:
100 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
CACNG2 Rabbit pAb (APR26614N) - image 1

CACNG2 Rabbit pAb (APR26614N)

  • Background:

    The protein encoded by this gene is a type I transmembrane AMPA receptor regulatory protein (TARP) . TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family. This gene is a susceptibility locus for schizophrenia.
  • Synonyms:

    CACNG2; MRD10
  • Gene ID:

    10369
  • UniProt:

    Q9Y698
  • Cellular Locus:

    Membrane, Multi-pass membrane protein
  • Dilution:

    WB 1:500 - 1:2000 IF 1:50 - 1:100
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 35kDa Observed MW: 36kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CACNG2 Rabbit pAb (APR26614N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10369
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q9Y698
  • AA Sequence:

    RHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSSSRSTEPSHSRDASPVGIKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVHNCIQKENKDSLHSNTANRRTTPV