SLC3A2/CD98hc Rabbit pAb (APR26029N)

CAT:
882-APR26029N-03
Size:
200 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
SLC3A2/CD98hc Rabbit pAb (APR26029N) - image 1

SLC3A2/CD98hc Rabbit pAb (APR26029N)

  • Background:

    This gene is a member of the solute carrier family and encodes a cell surface, transmembrane protein. The protein exists as the heavy chain of a heterodimer, covalently bound through di-sulfide bonds to one of several possible light chains. The encoded transporter plays a role in regulation of intracellular calcium levels and transports L-type amino acids. Alternatively spliced transcript variants, encoding different isoforms, have been characterized.
  • Synonyms:

    SLC3A2; 4F2; 4F2HC; 4T2HC; CD98; CD98HC; MDU1; NACAE
  • Gene ID:

    6520
  • UniProt:

    P08195
  • Cellular Locus:

    Apical cell membrane, Melanosome, Single-pass type II membrane protein
  • Dilution:

    WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 57kDa/61kDa/67kDa/71kDa Observed MW: 75-100KDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC3A2/CD98hc Rabbit pAb (APR26029N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6520
  • Uniprot URL:

    https://www.uniprot.org/uniprot/P08195
  • AA Sequence:

    PGTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAA