VAMP4 Rabbit pAb (APR25452N)

CAT:
882-APR25452N-03
Size:
200 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
VAMP4 Rabbit pAb (APR25452N) - image 1

VAMP4 Rabbit pAb (APR25452N)

  • Background:

    Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP) /synaptobrevin family. This protein may play a role in trans-Golgi network-to-endosome transport.
  • Synonyms:

    VAMP4; VAMP-4; VAMP24
  • Gene ID:

    8674
  • UniProt:

    O75379
  • Cellular Locus:

    Golgi apparatus, Single-pass type IV membrane protein, trans-Golgi network membrane
  • Dilution:

    WB 1:200 - 1:2000 IHC 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 16kDa Observed MW: 16kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality VAMP4 Rabbit pAb (APR25452N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8674
  • Uniprot URL:

    https://www.uniprot.org/uniprot/O75379
  • AA Sequence:

    MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCK