LAMTOR5 Rabbit pAb (APR24885N)

• Background:

  This gene encodes a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx) . The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus.

• Synonyms:

  LAMTOR5; HBXIP; XIP

• Gene ID:

  10542

• UniProt:

  O43504

• Cellular Locus:

  Cytoplasm, Lysosome

• Dilution:

  WB 1:500 - 1:1000 IF 1:50 - 1:200

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 9kDa Observed MW: 10KDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LAMTOR5 Rabbit pAb (APR24885N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10542

• Uniprot URL:

  https://www.uniprot.org/uniprot/O43504

• AA Sequence:

  MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAVPLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS