[KO Validated] EDF1 Rabbit pAb (APR24746N)

CAT:
882-APR24746N-03
Size:
200 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
[KO Validated] EDF1 Rabbit pAb (APR24746N) - image 1

[KO Validated] EDF1 Rabbit pAb (APR24746N)

  • Background:

    This gene encodes a protein that may regulate endothelial cell differentiation, lipid metabolism, and hormone-induced cardiomyocyte hypertrophy. The encoded protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Alternate splicing results in multiple transcript variants.
  • Synonyms:

    EDF1; CFAP280; EDF-1; MBF1
  • Gene ID:

    8721
  • UniProt:

    O60869
  • Cellular Locus:

    Cytoplasm, Nucleus
  • Dilution:

    WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 15kDa/16kDa Observed MW: 16kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] EDF1 Rabbit pAb (APR24746N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8721
  • Uniprot URL:

    https://www.uniprot.org/uniprot/O60869
  • AA Sequence:

    MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK