KAT8/MYST1/MOF Rabbit pAb (APR24722N)

CAT:
882-APR24722N-03
Size:
200 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
KAT8/MYST1/MOF Rabbit pAb (APR24722N) - image 1

KAT8/MYST1/MOF Rabbit pAb (APR24722N)

  • Background:

    This gene encodes a member of the MYST histone acetylase protein family. The encoded protein has a characteristic MYST domain containing an acetyl-CoA-binding site, a chromodomain typical of proteins which bind histones, and a C2HC-type zinc finger. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Synonyms:

    KAT8; MOF; MYST1; ZC2HC8; hMOF
  • Gene ID:

    84148
  • UniProt:

    Q9H7Z6
  • Cellular Locus:

    Chromosome, Nucleus
  • Dilution:

    WB 1:500 - 1:2000 IF 1:100 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 52kDa/53kDa Observed MW: 53KDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KAT8/MYST1/MOF Rabbit pAb (APR24722N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=84148
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q9H7Z6
  • AA Sequence:

    MAAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGEPEVTVEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPED