[KO Validated] CD147/BSG Rabbit pAb (APR24170N)
CAT:
882-APR24170N-03
Size:
200 µL
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
![[KO Validated] CD147/BSG Rabbit pAb (APR24170N) - image 1](/gentaur-product-1.webp)
![[KO Validated] CD147/BSG Rabbit pAb (APR24170N) - image 1](/gentaur-product-1.webp)
[KO Validated] CD147/BSG Rabbit pAb (APR24170N)
Background:
The protein encoded by this gene is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene.Synonyms:
BSG; 5F7; CD147; EMMPRIN; OK; TCSF; basiginGene ID:
682UniProt:
P35613Cellular Locus:
Cell membrane, Melanosome, Single-pass type I membrane proteinDilution:
WB 1:500 - 1:2000 IHC 1:50 - 1:200Form:
LiquidBuffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight:
Calculated MW: 19kDa/22kDa/29kDa/42kDa Observed MW: 48-58kDaStorage Conditions:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview:
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] CD147/BSG Rabbit pAb (APR24170N) .Gene ID URL:
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=682Uniprot URL:
https://www.uniprot.org/uniprot/P35613AA Sequence:
DSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITL