ARPC5L Rabbit pAb (APR22493N)

CAT:
882-APR22493N-03
Size:
200 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
ARPC5L Rabbit pAb (APR22493N) - image 1

ARPC5L Rabbit pAb (APR22493N)

  • Background:

    May function as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF mediates the formation of branched actin networks.
  • Synonyms:

    ARPC5L; ARC16-2
  • Gene ID:

    81873
  • UniProt:

    Q9BPX5
  • Cellular Locus:

    Cytoplasm, cytoskeleton
  • Dilution:

    WB 1:500 - 1:2000 IHC 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 16kDa Observed MW: 17kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ARPC5L Rabbit pAb (APR22488N4) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=81873
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q9BPX5
  • AA Sequence:

    MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSL