MYEF2 Rabbit pAb (APR22410N)

CAT:
882-APR22410N-03
Size:
200 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
MYEF2 Rabbit pAb (APR22410N) - image 1

MYEF2 Rabbit pAb (APR22410N)

  • Background:

    Transcriptional repressor of the myelin basic protein gene (MBP. Binds to the proximal MB1 element 5'-TTGTCC-3' of the MBP promoter. Its binding to MB1 and function are inhibited by PURA (By similarity.
  • Synonyms:

    MYEF2; HsT18564; MEF-2; MST156; MSTP156; myEF-2
  • Gene ID:

    50804
  • UniProt:

    Q9P2K5
  • Cellular Locus:

    Nucleus
  • Dilution:

    WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 14kDa/20kDa/61kDa/64kDa Observed MW: 64kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MYEF2 Rabbit pAb (APR22410N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=50804
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q9P2K5
  • AA Sequence:

    MADANKAEVPGATGGDSPHLQPAEPPGEPRREPHPAEAEKQQPQHSSSSNGVKMENDESAKEEKSDLKEKSTGSKKANRFHPYSKDKNSGTGEKKGPNRNRVFISNIPYDMKWQAIKDLM