YWHAZ Rabbit pAb (APR21347N)

CAT:
882-APR21347N-03
Size:
200 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
YWHAZ Rabbit pAb (APR21347N) - image 1

YWHAZ Rabbit pAb (APR21347N)

  • Background:

    This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.
  • Synonyms:

    YWHAZ; 14-3-3-zeta; HEL-S-3; HEL-S-93; HEL4; KCIP-1; YWHAD
  • Gene ID:

    7534
  • UniProt:

    P63104
  • Cellular Locus:

    Cytoplasm, Melanosome
  • Dilution:

    WB 1:500 - 1:2000 IHC 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 19kDa/27kDa Observed MW: Refer to figures
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality YWHAZ Rabbit pAb (APR21347N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7534
  • Uniprot URL:

    https://www.uniprot.org/uniprot/P63104
  • AA Sequence:

    MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSL