CRMP5/DPYSL5 Rabbit pAb (APR20456N)

CAT:
882-APR20456N-03
Size:
200 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
CRMP5/DPYSL5 Rabbit pAb (APR20456N) - image 1

CRMP5/DPYSL5 Rabbit pAb (APR20456N)

  • Background:

    This gene encodes a member of the CRMP (collapsing response mediator protein) family thought to be involved in neural development. Antibodies to the encoded protein were found in some patients with neurologic symptoms who had paraneoplastic syndrome. A pseudogene of this gene is found on chromosome 11. Multiple alternatively spliced variants, encoding the same protein, have been identified.
  • Synonyms:

    DPYSL5; CRAM; CRMP-5; CRMP5; Ulip6
  • Gene ID:

    56896
  • UniProt:

    Q9BPU6
  • Cellular Locus:

    Cytoplasm
  • Dilution:

    WB 1:500 - 1:2000
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 61kDa Observed MW: 61kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CRMP5/DPYSL5 Rabbit pAb (APR20456N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=56896
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q9BPU6
  • AA Sequence:

    VVYENGVFMCAEGTGKFCPLRSFPDTVYKKLVQREKTLKVRGVDRTPYLGDVAVVVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW