CD127/IL7R Rabbit pAb (APR20091N)

CAT:
882-APR20091N-03
Size:
200 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
CD127/IL7R Rabbit pAb (APR20091N) - image 1

CD127/IL7R Rabbit pAb (APR20091N)

  • Background:

    The protein encoded by this gene is a receptor for interleukin 7 (IL7) . The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukins 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in V (D) J recombination during lymphocyte development. Defects in this gene may be associated with severe combined immunodeficiency (SCID) . Alternatively spliced transcript variants have been found.
  • Synonyms:

    IL7R; CD127; CDW127; IL-7R-alpha; IL7RA; ILRA
  • Gene ID:

    3575
  • UniProt:

    P16871
  • Cellular Locus:

    Cell membrane, Secreted, Single-pass type I membrane protein, Single-pass type I membrane protein
  • Dilution:

    WB 1:500 - 1:2000 IP 1:50 - 1:100
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 65-90kDa Observed MW: 72KDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD127/IL7R Rabbit pAb (APR20091N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3575
  • Uniprot URL:

    https://www.uniprot.org/uniprot/P16871
  • AA Sequence:

    ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMD