SLC25A38 Rabbit pAb (APR19817N)

CAT:
882-APR19817N-03
Size:
200 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
SLC25A38 Rabbit pAb (APR19817N) - image 1

SLC25A38 Rabbit pAb (APR19817N)

  • Background:

    This gene is a member of the mitochondrial carrier family. The encoded protein is required during erythropoiesis and is important for the biosynthesis of heme. Mutations in this gene are the cause of autosomal congenital sideroblastic anemia.
  • Synonyms:

    SLC25A38; SIDBA2
  • Gene ID:

    54977
  • UniProt:

    Q96DW6
  • Cellular Locus:

    Mitochondrion inner membrane, Multi-pass membrane protein
  • Dilution:

    WB 1:500 - 1:2000 IF 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 33kDa Observed MW: 33kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC25A38 Rabbit pAb (APR19817N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=54977
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q96DW6
  • AA Sequence:

    CMSPITVIKTRYESGKYGYESIYAALRSIYHSEGHRGLFSGLTATLLRDAPFSGIYLMFYNQTKNIVPHDQVDATLIPITN