[KO Validated] Hexokinase II Rabbit pAb (APR17631N)

CAT:
882-APR17631N-02
Size:
100 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
[KO Validated] Hexokinase II Rabbit pAb (APR17631N) - image 1

[KO Validated] Hexokinase II Rabbit pAb (APR17631N)

  • Background:

    Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells.
  • Synonyms:

    HK2; HKII; HXK2; hexokinase-2
  • Gene ID:

    3099
  • UniProt:

    P52789
  • Cellular Locus:

    Mitochondrion outer membrane
  • Applications:

    WB (H460, unknow, SK-N-SH, U251, U87MG, Homo sapiens, Mus musculus, Rattus norvegicus) IHC (Mus musculus, Homo sapiens, Rattus norvegicus) IF (Homo sapiens)
  • Dilution:

    WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 102kDa Observed MW: 102KDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] Hexokinase II Rabbit pAb (APR17631N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3099
  • Uniprot URL:

    https://www.uniprot.org/uniprot/P52789
  • AA Sequence:

    MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR