Recombinant Human Activin receptor type-2A (ACVR2A) , partial (Active)
CAT:
399-CSB-MP001260HU1-03
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No








Recombinant Human Activin receptor type-2A (ACVR2A) , partial (Active)
- CAS Number: 9000-83-3
- Gene Name: ACVR2A
- UniProt: P27037
- Expression Region: 20-135aa
- Organism: Homo sapiens
- Target Sequence: AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP
- Tag: C-terminal 10xHis-tagged
- Source: Mammalian cell
- Field of Research: Signal Transduction
- Assay Type: Active Protein & In Stock Protein
- Relevance: On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin A, activin B and inhibin A. Mediates induction of adipogenesis by GDF6.
- Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
- Purity: Greater than 95% as determined by SDS-PAGE.
- Activity: Yes
- Bioactivity: Measured by its binding ability in a functional ELISA. Immobilized Human ACVR2A at 2 μg/mL can bind Anti-ACVR2A&ACVR2B recombinant antibody (CSB-RA623829MA1HU). The EC50 is 3.848-4.375 ng/mL.
- Length: Partial
- Form: Lyophilized powder
- Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 14.8kDa
- References & Citations: Activin a Receptor Type 2A Mutation Affects the Tumor Biology of Microsatellite Instability-High Gastric Cancer. Yuza K., Nagahashi M., Ichikawa H., Hanyu T., Nakajima M., Shimada Y., Ishikawa T., Sakata J., Takeuchi S., Wakai T. J Gastrointest Surg 25:2231-2241 (2021)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Protein Length: Partial