Recombinant Mesocricetus auratus Multifunctional fusion protein (Il1b)

Recombinant Mesocricetus auratus Multifunctional fusion protein (Il1b)

• CAS Number: 9000-83-3
• Gene Name: Il1b
• UniProt: A0A1U7Q9G0
• Expression Region: 1-267aa
• Organism: Mesocricetus auratus (Golden hamster)
• Target Sequence: MATVPELDSEMIAFHSDENDLFFEVDGLQKMKSCFQSLDLSYPDESIQLQISKQDLNKSFRQVVSVIVAVEKLWNTPVPCPWTFQDEDLRTFFSFIFEEEPIFCDSWDGELIVADAPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNINQQVVFSMSFVQGETSNNKIPVALGLKGKNLYLSCVMKGDTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHKPVFLGNNSGQDLVDFTMESVSS
• Tag: Email us to check on the available tags
• Source: E.coli
• Field of Research: Others
• Assay Type: In Stock Protein
• Relevance: Potent pro-inflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells. Plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6. Involved in transduction of inflammation downstream of pyroptosis: its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Activity: Not Test
• Length: Full Length
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 32.6 kDa
• References & Citations: 1 RefSeq Submitted (APR-2022) to UniProtKB Cited for: IDENTIFICATION.
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.