Recombinant Human NADH-cytochrome b5 reductase 2 (CYB5R2)
CAT:
399-CSB-EP738178HU (A4)-02
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Human NADH-cytochrome b5 reductase 2 (CYB5R2)
Product Name Alternative:
B5R.2, CYB5R2Gene Name:
CYB5R2UniProt:
Q6BCY4-2Expression Region:
1-237aaOrganism:
Homo sapiens (Human)Tag:
N-terminal 6xHis-GST-taggedType:
Developed ProteinSource:
E.coliField of Research:
CardiovascularEndotoxin:
Not testedPurity:
Greater than 85% as determined by SDS-PAGE.Form:
Liquid or Lyophilized powderBuffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.Molecular Weight:
58.5 kDaShelf Life:
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.Protein Length:
Full Length of Isoform 2Target Description:
MNSRRREPITLQDPEAKYPLPLIEKEKISHNTRRFRFGLPSPDHVLGLPVGNYVQLLAKIDNELVVRAYTPVSSDDDRGFVDLIIKIYFKNVHPQYPEGGKMTQYLENMKIGETIFFRGPRGRLFYHGPGNLGIRPDQTSEPKKTLADHLGMIAGGTGITPMLQLIRHITKDPSDRTRMSLIFANQTEEDILVRKELEEIARTHPDQFNLWYTLDRPPIGPWSAEGATLLSNSAQFH