Recombinant Escherichia coli Bacterioferritin (bfr)
CAT:
399-CSB-EP364636ENV-03
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Escherichia coli Bacterioferritin (bfr)
- Product Name Alternative: Cytochrome b-1, Cytochrome b-557
- Gene Name: Bfr
- UniProt: P0ABD3
- Expression Region: 1-158aa
- Organism: Escherichia coli (strain K12)
- Tag: C-terminal 6xHis-tagged
- Type: In Stock Protein
- Source: E.coli
- Field of Research: Others
- Endotoxin: Not tested
- Purity: Greater than 95% as determined by SDS-PAGE.
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 25.4 kDa
- Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
- Protein Length: Full Length
- Target Description: MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREEG
