Recombinant Bothrops asper Snake venom metalloproteinase BaP1

CAT:
399-CSB-EP306655BUT-02
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Bothrops asper Snake venom metalloproteinase BaP1 - image 1

Recombinant Bothrops asper Snake venom metalloproteinase BaP1

  • Product Name Alternative:

    (SVMP) (Hemorrhagic metalloproteinase BaP1) (Bap-1)
  • Abbreviation:

    Recombinant Bothrops asper Snake venom metalloproteinase BaP1 protein
  • UniProt:

    P83512
  • Expression Region:

    192-394aa
  • Organism:

    Bothrops asper (Terciopelo)
  • Target Sequence:

    QQRFSPRYIELAVVADHGIFTKYNSNLNTIRTRVHEMLNTVNGFYRSVDVHAPLANLEVWSKQDLIKVQKDSSKTLKSFGEWRERDLLPRISHDHAQLLTAVVFDGNTIGRAYTGGMCDPRHSVGVVRDHSKNNLWVAVTMAHELGHNLGIHHDTGSCSCGAKSCIMASVLSKVLSYEFSDCSQNQYETYLTNHNPQCILNKP
  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    Zinc metalloprotease that exhibits a weak hemorrhagic activity (with a minimum hemorrhagic dose of 20 ug by intradermal and intramuscular injection into mice) . The basal membrane components collagen (all chains of type IV) (COL4A4), laminin and nidogen are all degraded by this toxin. Rapidly degrades the Aalpha-chain (FGA) of fibrinogen, and later on, degrades the Bbeta-chain (FGB) of fibrinogen. Also activates the complement system, and induces rat neutrophil chemotaxis. Induces edema in mouse food pad and shows a mild myotoxicity.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    30.3 kDa
  • References & Citations:

    "Proteomic analysis of Bothrops pirajai snake venom and characterization of BpirMP, a new P-I metalloproteinase." Bernardes C.P., Menaldo D.L., Camacho E., Rosa J.C., Escalante T., Rucavado A., Lomonte B., Gutierrez J.M., Sampaio S.V. J. Proteomics 80:250-267 (2013)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein