Recombinant Human Beta-defensin 1 protein (DEFB1) (Active)

Recombinant Human Beta-defensin 1 protein (DEFB1) (Active)

• CAS Number: 9000-83-3
• Gene Name: DEFB1, BD1, HBD1
• UniProt: P60022
• Expression Region: 22-68aa
• Organism: Homo sapiens
• Target Sequence: GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
• Tag: Tag-Free
• Source: E.Coli
• Field of Research: Microbiology
• Assay Type: Active Protein & In Stock Protein
• Relevance: Has bactericidal activity. {ECO:0000250}.
• Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
• Purity: >98% as determined by SDS-PAGE.
• Activity: Yes
• Bioactivity: Fully biologically active when compared to standard. The biological activity determined by a chemotaXIs bioassay using CD34+ dendritic cells is in a concentration range of 100.0-1000.0 ng/ml.
• Length: Full Length
• Form: Lyophilized powder
• Buffer: Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 130 mM NaCl
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Function: Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility
• Molecular Weight: 5.1 kDa
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.