Recombinant Methanothermus fervidus DNA-binding protein HMf-2 (hmfB)

CAT:
399-CSB-EP322515MFF-02
Size:
100 µg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Methanothermus fervidus DNA-binding protein HMf-2 (hmfB) - image 1

Recombinant Methanothermus fervidus DNA-binding protein HMf-2 (hmfB)

  • Gene Name:

    hmfB
  • UniProt:

    P19267
  • Expression Region:

    1-69aa
  • Organism:

    Methanothermus fervidus
  • Target Sequence:

    MELPIAPIGRIIKDAGAERVSDDARITLAKILEEMGRDIASEAIKLARHAGRKTIKAEDIELAVRRFKK
  • Tag:

    N-terminal 6xHis-tagged
  • Source:

    E.coli
  • Field of Research:

    Cancer
  • Assay Type:

    In Stock Protein
  • Relevance:

    Binds and compacts DNA (95 to 150 base pairs) to form nucleosome-like structures that contain positive DNA supercoils (PubMed:2377617, PubMed:7809089, PubMed:10704305, PubMed:28798133). Increases the resistance of DNA to thermal denaturation in vitro (PubMed:2377617).
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Length:

    Full Length
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    11.7 kDa
  • References & Citations:

    "HMf, a DNA-binding protein isolated from the hyperthermophilic archaeon Methanothermus fervidus, is most closely related to histones." Sandman K.M., Krzycki J.A., Dobrinski B., Lurz R., Reeve J.N. Proc. Natl. Acad. Sci. U.S.A. 87:5788-5791 (1990)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • CAS Number:

    9000-83-3