LITAF Recombinant Protein (Human)

• Gene Name:

  Lipopolysaccharide induced TNF factor

• Gene Aliases:

  Lipopolysaccharide-induced TNF-alpha factor; lipopolysaccharide-induced tumor necrosis factor-alpha factor; LPS-induced TNF-alpha factor; p53-induced gene 7 protein; PIG7; SIMPLE; small integral membrane protein of lysosome/late endosome; TP53I7; tumor protein p53 inducible protein 7.

• Gene ID:

  9516

• Accession Number:

  NP_001129944

• Reactivity:

  Homo sapiens|Human

• Target:

  Plays a role in endosomal protein trafficking and in targeting proteins for lysosomal degradation (PubMed:23166352) . Plays a role in targeting endocytosed EGFR and ERGG3 for lysosomal degradation, and thereby helps downregulate downstream signaling cascades (PubMed:23166352) . Helps recruit the ESCRT complex components TSG101, HGS and STAM to cytoplasmic membranes (PubMed:23166352) . Probably plays a role in regulating protein degradation via its interaction with NEDD4 (PubMed:15776429) . May also contribute to the regulation of gene expression in the nucleus (PubMed:10200294, PubMed:15793005) . Binds DNA (in vitro) and may play a synergistic role with STAT6 in the nucleus in regulating the expression of various cytokines (PubMed:15793005) . May regulate the expression of numerous cytokines, such as TNF, CCL2, CCL5, CXCL1, IL1A and IL10 (PubMed:10200294, PubMed:15793005) .

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  44.1 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  LITAF

• Protein Name:

  Lipopolysaccharide-induced tumor necrosis factor-alpha factor

• Gene Name URL:

  LITAF

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001136472