PSME1 Recombinant Protein (Human)

CAT:
247-OPCA04860-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PSME1 Recombinant Protein (Human) - image 1

PSME1 Recombinant Protein (Human)

  • Gene Name:

    Proteasome activator subunit 1
  • Gene Aliases:

    11S regulator complex subunit alpha;29-kD MCP activator subunit; activator of multicatalytic protease subunit 1; epididymis secretory sperm binding protein Li 129m; HEL-S-129m; IFI5111; IGUP I-5111; interferon gamma up-regulated I-5111 protein; interferon-gamma IEF SSP 5111; interferon-gamma-inducible protein 5111; PA28A; PA28alpha; proteasome (prosome, macropain) activator subunit 1 (PA28 alpha) ; Proteasome activator 28 subunit alpha; proteasome activator complex subunit 1; REGalpha.
  • Gene ID:

    5720
  • Accession Number:

    NP_001268457
  • Reactivity:

    Homo sapiens|Human
  • Target:

    Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.
  • Type:

    Protein
  • Source:

    E.coli
  • Sequence:

    MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    55.7 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    PSME1
  • Protein Name:

    Proteasome activator complex subunit 1
  • Gene Name URL:

    PSME1
  • CAS Number:

    9000-83-3
  • Nucleotide Accession Number:

    NM_001281528