DPS Recombinant Protein (Campylobacter pylori)

• Gene Name:

  DNA starvation/stationary phase protection protein

• Gene Aliases:

  Bacterioferritin; DNA starvation/stationary phase protection protein; HP_0243; HP_RS01195; HP0243; HP-NAP; Neutrophil-activating protein A.

• Gene ID:

  898765

• Reactivity:

  Helicobacter pylori

• Target:

  Protects DNA from oxidative damage by sequestering intracellular Fe (2+) ion and storing it in the form of Fe (3+) oxyhydroxide mineral. One hydrogen peroxide oxidizes two Fe (2+) ions, which prevents hydroxyl radical production by the Fenton reaction (By similarity) . Required for the survival in the presence of oxidative stress. Dps is also a virulence factor that activates neutrophils, mast cells and monocytes. It binds to neutrophil-glycosphingolipids and to sulfated carbohydrates on mucin. It might have a role in the accumulation of neutrophils and monocytes at the site of infection. Induces superoxide anion generation, adhesion and chemotaxis of neutrophils, through a pertussis toxin-sensitive pathway involving MAP kinases.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  32.9 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  HP_RS01195

• Protein Name:

  DNA protection during starvation protein

• Gene Name URL:

  HP_RS01195

• CAS Number:

  9000-83-3