IFNA1 MORE Recombinant Protein (Human)

• Gene Name:

  Interferon alpha 1|interferon alpha 13

• Gene Aliases:

  IFL; IFN; IFNA@; IFNA13; IFN-ALPHA; IFN-alpha-1/13; IFN-alphaD; interferon alpha 1b; interferon alpha-1/13; interferon alpha-D; interferon-alpha1; leIF D.

• Gene ID:

  3439|3447

• Accession Number:

  NP_008831

• Reactivity:

  Homo sapiens|Human

• Target:

  Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  35.4 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  IFNA1|IFNA13

• Protein Name:

  Interferon alpha-1/13

• Gene Name URL:

  IFNA1|IFNA13

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_006900