Nqo1 Recombinant Protein

CAT:
247-OPCA03267-20UG
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Nqo1 Recombinant Protein - image 1

Nqo1 Recombinant Protein

  • Gene Name:

    NAD (P) H dehydrogenase, quinone 1
  • Gene Aliases:

    AV001255; azoreductase; Di; Dia4; diaphorase 4 (NADH/NADPH) ; Dtd; DT-diaphorase; menadione reductase; NAD (P) H dehydrogenase (quinone) ; NAD (P) H dehydrogenase [quinone] 1; NAD (P) H menadione oxidoreductase 1, dioxin inducible; NAD (P) H:quinone oxidoreductase 1; NM; Nmo1; Nmo-1; Nmor1; NQ; Ox; Ox-; Ox1; Ox-1; phylloquinone reductase; QR; Qr1; quinone reductase 1.
  • Gene ID:

    18104
  • Accession Number:

    NP_032732.3
  • Reactivity:

    Mouse|Mus musculus
  • Target:

    The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.
  • Type:

    Protein
  • Source:

    Yeast
  • Sequence:

    AARRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGELKDSKNFQYPSESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVAGFAYTYAAMYDNGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARMQILEGWKKRLETVWEETPLYFAPSSLFDLNFQAGFLMKKEVQEEQKKNKFGLSVGHHLGKSIPADNQIKARK
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    32.8 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    Nqo1
  • Host or Source:

    Mouse
  • Protein Name:

    NAD (P) H dehydrogenase [quinone] 1
  • Gene Name URL:

    Nqo1
  • CAS Number:

    9000-83-3
  • Nucleotide Accession Number:

    NM_008706.5