CD300LF Recombinant Protein

CAT:
247-OPCA03048-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
CD300LF Recombinant Protein - image 1

CD300LF Recombinant Protein

  • Gene Name:

    CD300 molecule like family member f
  • Gene Aliases:

    CD300 antigen-like family member F; CD300f; CLM1; CLM-1; CMRF35-like molecule 1; IgSF13; immune receptor expressed on myeloid cells 1; immunoglobin superfamily member 13; immunoglobulin superfamily member 13; inhibitory receptor IREM1; IREM1; IREM-1; LMIR3; NK inhibitory receptor; NKIR.
  • Gene ID:

    146722
  • Accession Number:

    NP_001276011.1
  • Reactivity:

    Homo sapiens|Human
  • Target:

    Acts as an inhibitory receptor for myeloid cells and mast cells (PubMed:15549731) . Positively regulates the phagocytosis of apoptotic cells (efferocytosis) via phosphatidylserine (PS) recognition; recognizes and binds PS as a ligand which is expressed on the surface of apoptotic cells. Plays an important role in the maintenance of immune homeostasis, by promoting macrophage-mediated efferocytosis and by inhibiting dendritic cell-mediated efferocytosis (By similarity) . Negatively regulates Fc epsilon receptor-dependent mast cell activation and allergic responses via binding to ceramide and sphingomyelin which act as ligands (PubMed:24035150) . May act as a coreceptor for interleukin 4 (IL-4) . Associates with and regulates IL-4 receptor alpha-mediated responses by augmenting IL-4- and IL-13-induced signaling (By similarity) . Negatively regulates the Toll-like receptor (TLR) signaling mediated by MYD88 and TRIF through activation of PTPN6/SHP-1 and PTPN11/SHP-2 (PubMed:22043923) . Inhibits osteoclast formation. Induces macrophage cell death upon engagement (By similarity) .
  • Type:

    Protein
  • Source:

    Yeast
  • Sequence:

    TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    17.5 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    CD300LF
  • Host or Source:

    Human
  • Protein Name:

    CMRF35-like molecule 1
  • Gene Name URL:

    CD300LF
  • CAS Number:

    9000-83-3
  • Nucleotide Accession Number:

    NM_001289082.1