SLC34A2 Recombinant Protein

• Gene Name:

  Solute carrier family 34 member 2

• Gene Aliases:

  Na (+) -dependent phosphate cotransporter 2B; NaPi3b; NAPI-3B; NAPI-IIb; NPTIIb; PULAM; sodium/phosphate cotransporter 2B; sodium-dependent phosphate transport protein 2B; solute carrier family 34 (sodium phosphate), member 2; solute carrier family 34 (type II sodium/phosphate cotransporter), member 2; Solute carrier family 34 member 2; type II sodium-dependent phosphate transporter 3b.

• Gene ID:

  10568

• Accession Number:

  NP_001171469.1

• Reactivity:

  Homo sapiens|Human

• Target:

  May be involved in actively transporting phosphate into cells via Na (+) cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli.

• Type:

  Protein

• Source:

  Yeast

• Sequence:

  LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  15.1 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  SLC34A2

• Host or Source:

  Human

• Protein Name:

  Sodium-dependent phosphate transport protein 2B

• Gene Name URL:

  SLC34A2

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001177998.1