LILRA5 Recombinant Protein

CAT:
247-OPCA01700-20UG
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
LILRA5 Recombinant Protein - image 1

LILRA5 Recombinant Protein

  • Gene Name:

    Leukocyte immunoglobulin like receptor A5
  • Gene Aliases:

    CD85; CD85 antigen-like family member F; CD85F; ILT11; ILT-11; Immunoglobulin-like transcript 11; immunoglobulin-like transcript 11 protein; leucocyte Ig-like receptor A5; leukocyte Ig-like receptor 9; leukocyte immunoglobulin-like receptor 9; leukocyte immunoglobulin-like receptor subfamily A member 5; leukocyte immunoglobulin-like receptor subfamily A member 5 soluble; leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 7; LILRB7; LIR9; LIR-9.
  • Gene ID:

    353514
  • Accession Number:

    NP_067073.1
  • Reactivity:

    Homo sapiens|Human
  • Target:

    May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition.
  • Type:

    Protein
  • Source:

    E.coli
  • Sequence:

    GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    29.2 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    LILRA5
  • Host or Source:

    Human
  • Protein Name:

    Leukocyte immunoglobulin-like receptor subfamily A member 5
  • Gene Name URL:

    LILRA5
  • CAS Number:

    9000-83-3
  • Nucleotide Accession Number:

    NM_021250.3