CXCL10 Recombinant Protein (Mouse)

• Gene Name:

  Chemokine (C-X-C motif) ligand 10

• Gene Aliases:

  10 kDa interferon gamma-induced protein; C7; CRG-; CRG-2; C-X-C motif chemokine 10; gamma-IP10; gIP-; gIP-10; Ifi; Ifi10; IN; INP10; interferon activated gene 10; interferon-gamma induced protein CRG-2; IP; IP-; IP10; IP-10; mob-; mob-1; Scyb1; Scyb10; small inducible cytokine B subfamily (Cys-X-Cys), member 10; small-inducible cytokine B10.

• Gene ID:

  15945

• Reactivity:

  Mouse|Mus musculus

• Target:

  In addition to its role as a proinflammatory cytokine, may participate in T-cell effector function and perhaps T-cell development.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  35.7 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  Cxcl10

• Protein Name:

  C-X-C motif chemokine 10

• Gene Name URL:

  Cxcl10

• CAS Number:

  9000-83-3