Recombinant Mouse Growth-regulated alpha protein

• Gene Name:

  Chemokine (C-X-C motif) ligand 1

• Gene Aliases:

  Alpha-chemokine; C-X-C motif chemokine 1; F; Fsp; Gr; gro; Gro1; GRO1 oncogene; growth-regulated alpha protein; KC; KC/GR) -alpha; KC/GRO-alpha; Mg; Mgsa; N5; N51; platelet-derived growth factor-inducible protein KC; Scyb; Scyb1; secretory protein N51.

• Gene ID:

  14825

• Reactivity:

  Mouse|Mus musculus

• Target:

  Has chemotactic activity for neutrophils. Contributes to neutrophil activation during inflammation (By similarity) . Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. KC (5-72) shows a highly enhanced hematopoietic activity.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  11.5 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  Cxcl1

• Protein Name:

  Growth-regulated alpha protein

• Gene Name URL:

  Cxcl1

• CAS Number:

  9000-83-3