Recombinant human Glycophorin-A

• Gene Name:

  Glycophorin A (MNS blood group)

• Gene Aliases:

  CD235a; erythroid-lineage-specific membrane sialoglycoprotein; glycophorin A (MN blood group) ; glycophorin A, GPA; glycophorin Erik; glycophorin MiI; glycophorin MiV; glycophorin SAT; glycophorin Sta type C; glycophorin-A; GPA; GPErik; GPSAT; HGpMiV; HGpMiXI; HGpSta (C) ; Mi.V glycoprotein (24 AA) ; MN; MN sialoglycoprotein; MNS; PAS-2; recombinant glycophorin A-B Miltenberger-DR; sialoglycoprotein alpha.

• Gene ID:

  2993

• Reactivity:

  Homo sapiens|Human

• Target:

  Recombinant human Glycophorin-A

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  34.9 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  GYPA

• Protein Name:

  Glycophorin

• Gene Name URL:

  GYPA

• CAS Number:

  9000-83-3