LDOC1 Antibody

• Gene Name:

  LDOC1 regulator of NFKB signaling

• Gene Aliases:

  BCUR1; breast cancer, up-regulated 1; leucine zipper downregulated in cancer; leucine zipper down-regulated in cancer 1; leucine zipper protein down-regulated in cancer cells; mammalian retrotransposon-derived 7; Mar7; Mart7; protein LDOC1; retrotransposon Gag like 7; RTL7; SIRH7; Sushi-Ichi retrotransposon homolog 7.

• Gene ID:

  23641

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_036449.1

• Reactivity:

  Human, Mouse

• Immunogen:

  LDOC1 (NP_036449.1, 1 a.a. ~ 146 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  The protein encoded by this gene contains a leucine zipper-like motif and a proline-rich region that shares marked similarity with an SH3-binding domain. The protein localizes to the nucleus and is down-regulated in some cancer cell lines. It is thought to regulate the transcriptional response mediated by the nuclear factor kappa B (NF-kappaB) . The gene has been proposed as a tumor suppressor gene whose protein product may have an important role in the development and/or progression of some cancers. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  300000

• Type:

  Monoclonal Antibody

• Sequence:

  MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDEEEEDDY

• Applications:

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG2a Kappa

• NCBI Gene Symbol:

  LDOC1

• Host or Source:

  Mouse

• Protein Name:

  Homo sapiens LDOC1, regulator of NFKB signaling (LDOC1), mRNA|protein LDOC1 [Homo sapiens]

• Gene Name URL:

  LDOC1

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_012317.2